PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A04G1063
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 169aa    MW: 19854.4 Da    PI: 6.3939
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A04G1063genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.43.1e-133894763
                 HHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1  7 errkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                  +r+++NRe+ArrsR RK++ ++ L +   +L+++N++ + +++  +++  +++se+
  Gh_A04G1063 38 RKRMISNRESARRSRMRKQKHLDDLMTQLTQLQKQNHEIITNINFTTQHLLNVESEN 94
                 69***************************************9999999988888877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.2E-133796IPR004827Basic-leucine zipper domain
PfamPF001706.6E-103783IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.3813797IPR004827Basic-leucine zipper domain
CDDcd147022.56E-203787No hitNo description
SuperFamilySSF579594.88E-123788No hitNo description
Gene3DG3DSA:1.20.5.1703.0E-1038111No hitNo description
PROSITE patternPS0003603954IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MFPILSEIFF SGFMINSTFI RRTHLVQSFS VVFLYWKRKR MISNRESARR SRMRKQKHLD  60
DLMTQLTQLQ KQNHEIITNI NFTTQHLLNV ESENSVLRAQ LNELTHRLQS LNEIISFLND  120
DHGDDDDDDD KTSIDFTQPA VADTAFLNPF HLAFLNQPIM ASADNTFQY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14855RRSRMRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.51061e-156boll| ovule| root
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX9640383e-48JX964038.1 Gossypium hirsutum clone NBRI_TRANS-307 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012458339.19e-75PREDICTED: ocs element-binding factor 1-like
TrEMBLA0A0D2V5R41e-115A0A0D2V5R4_G
STRINGPOPTR_0009s12250.11e-50(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50128154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34590.12e-34G-box binding factor 6